ZBTB48 Antibody - middle region : Biotin

ZBTB48 Antibody - middle region : Biotin
Artikelnummer
AVIARP58014_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: ZBTB48 contains 1 BTB (POZ) domain and 11 C2H2-type zinc fingers. It belongs to the krueppel C2H2-type zinc-finger protein family and binds to and regulates the J and/or S elements in MHC II promoter.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZBTB48

Key Reference: Maris,J.M., (1997) Eur. J. Cancer 33 (12), 1991-1996

Molecular Weight: 77kDa

Peptide Sequence: Synthetic peptide located within the following region: EFCSHAFTQKANLNMHLRTHTGEKPFQCHLCGKTFRTQASLDKHNRTHTG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc finger and BTB domain-containing protein 48

Protein Size: 688

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58014_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58014_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3104
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×