ZBTB48 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: ZBTB48 contains 1 BTB (POZ) domain and 11 C2H2-type zinc fingers. It belongs to the krueppel C2H2-type zinc-finger protein family and binds to and regulates the J and/or S elements in MHC II promoter.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZBTB48

Key Reference: Maris,J.M., (1997) Eur. J. Cancer 33 (12), 1991-1996

Molecular Weight: 77kDa

Peptide Sequence: Synthetic peptide located within the following region: EFCSHAFTQKANLNMHLRTHTGEKPFQCHLCGKTFRTQASLDKHNRTHTG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Zinc finger and BTB domain-containing protein 48

Protein Size: 688

Purification: Affinity Purified

• Artikelnummer: AVIARP58014_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58014_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 3104
• Wirt: Rabbit