ZHX3 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This protein is a member of the zinc fingers and homeoboxes (ZHX) gene family. The encoded protein contains two C2H2-type zinc fingers and five homeodomains and forms a dimer with itself or with zinc fingers and homeoboxes family member 1. In the nucleus, the dimerized protein interacts with the A subunit of the ubiquitous transcription factor nuclear factor-Y and may function as a transcriptional repressor.This gene encodes a member of the zinc fingers and homeoboxes (ZHX) gene family. The encoded protein contains two C2H2-type zinc fingers and five homeodomains and forms a dimer with itself or with zinc fingers and homeoboxes family member 1. In the nucleus, the dimerized protein interacts with the A subunit of the ubiquitous transcription factor nuclear factor-Y and may function as a transcriptional repressor.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZHX3

Key Reference: Liu,G., (2006) J. Biol. Chem. 281 (51), 39681-39692

Molecular Weight: 105kDa

Peptide Sequence: Synthetic peptide located within the following region: ETKMTRREIDSWFSERRKKVNAEETKKAEENASQEEEEAAEDEGGEEDLA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc fingers and homeoboxes protein 3

Protein Size: 956

Purification: Affinity Purified

• Artikelnummer: AVIARP57983_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57983_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rat (Rattus), Rabbit, Guinea Pig
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 23051
• Wirt: Rabbit