ZNF157 Antibody - N-terminal region : FITC

ZNF157 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57911_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene product is a likely zinc finger family transcription factor. It contains KRAB-A and KRAB-B domains that act as transcriptional repressors in related proteins, and multiple zinc finger DNA binding motifs and finger linking regions characteristic of the Kruppel family. This gene is part of a gene cluster on chromosome Xp11.23.

Immunogen: The immunogen for Anti-ZNF157 antibody is: synthetic peptide directed towards the N-terminal region of Human ZN157

Key Reference: N/A

Molecular Weight: 55 kDa

Peptide Sequence: Synthetic peptide located within the following region: TYSNLASVGLCVAKPEMIFKLERGEELWILEEESSGHGYSGSLSLLCGNG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc finger protein 157

Protein Size: 506

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP57911_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57911_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Pig (Porcine), Rabbit, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 7712
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×