English
ZNF224 Antibody - middle region : Biotin
ZNF224 Antibody - middle region : Biotin
Artikelnummer
AVIARP58369_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: Matrix-assisted laser desorption ionization-time of flight analysis and examination of protein profiles from the SwissProt database revealed that the previously defined p97 repressor is ZNF224, a zinc finger protein. ZNF224, a Kruppel-like zinc finger transcription factor, is the repressor protein that specifically binds to the negative cis-element AldA-NRE and affects the AldA-NRE-mediated transcription.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF224
Molecular Weight: 82
Peptide Sequence: Synthetic peptide located within the following region: SGEKPFKCEECGKGFYTNSQCYSHQRSHSGEKPYKCVECGKGYKRRLDLD
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Zinc finger protein 224
Protein Size: 707
Purification: Affinity Purified
Description of Target: Matrix-assisted laser desorption ionization-time of flight analysis and examination of protein profiles from the SwissProt database revealed that the previously defined p97 repressor is ZNF224, a zinc finger protein. ZNF224, a Kruppel-like zinc finger transcription factor, is the repressor protein that specifically binds to the negative cis-element AldA-NRE and affects the AldA-NRE-mediated transcription.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF224
Molecular Weight: 82
Peptide Sequence: Synthetic peptide located within the following region: SGEKPFKCEECGKGFYTNSQCYSHQRSHSGEKPYKCVECGKGYKRRLDLD
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Zinc finger protein 224
Protein Size: 707
Purification: Affinity Purified
| Artikelnummer | AVIARP58369_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP58369_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Zebrafish, Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 7767 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
