ZNF675 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ZNF675 may be involved in transcriptional regulation. It may play a role during osteoclast differentiation by modulating TRAF6 signaling activity.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF675

Key Reference: Colland,F., (2004) Genome Res. 14 (7), 1324-1332

Molecular Weight: 66kDa

Peptide Sequence: Synthetic peptide located within the following region: CDKYVKVFNKFSHSDRHKIKHMENKPFKCKECGRSFCMLSHLTRHERNYT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc finger protein 675

Protein Size: 568

Purification: Affinity Purified

• Artikelnummer: AVIARP57962_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57962_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 171392
• Wirt: Rabbit