ZNF676 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: ZNF676 may be involved in transcriptional regulation.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ZNF676

Molecular Weight: 64kDa

Peptide Sequence: Synthetic peptide located within the following region: SSTLTYYKSIHTGEKPYKCEECGKAFSKFSILTKHKVIHTGEKPYKCEEC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc finger protein 676

Protein Size: 588

Purification: Affinity Purified

• Artikelnummer: AVIARP58109_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58109_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 163223
• Wirt: Rabbit