ZNF676 Antibody - middle region : FITC

ZNF676 Antibody - middle region : FITC
Artikelnummer
AVIARP58109_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ZNF676 may be involved in transcriptional regulation.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ZNF676

Molecular Weight: 64kDa

Peptide Sequence: Synthetic peptide located within the following region: SSTLTYYKSIHTGEKPYKCEECGKAFSKFSILTKHKVIHTGEKPYKCEEC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc finger protein 676

Protein Size: 588

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58109_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58109_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 163223
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×