ZNF676 Antibody - middle region : HRP

ZNF676 Antibody - middle region : HRP
Artikelnummer
AVIARP58109_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: ZNF676 may be involved in transcriptional regulation.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ZNF676

Molecular Weight: 64kDa

Peptide Sequence: Synthetic peptide located within the following region: SSTLTYYKSIHTGEKPYKCEECGKAFSKFSILTKHKVIHTGEKPYKCEEC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Zinc finger protein 676

Protein Size: 588

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58109_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58109_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 163223
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×