ZNF765 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The exact function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF765

Molecular Weight: 62kDa

Peptide Sequence: Synthetic peptide located within the following region: MALPQGLLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLDIS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc finger protein 765

Protein Size: 523

Purification: Affinity Purified

• Artikelnummer: AVIARP58368_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58368_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 91661
• Wirt: Rabbit