Recombinant Human Galectin-9 (LGALS9)

Purity: Greater than 90% as determined by SDS-PAGE.

Species: Homo sapiens (Human).

Source: E.coli.

Expression Region: 1-323aa.

Molecular Weight: 65.9kDa.

Tag Info: N-terminal 6xHis-GST-tagged.

Form: Liquid or Lyophilized powder.

Target Protein Sequence: MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT.



Tag Info: N-terminal 6xHis-GST-tagged. MW: 65.9 kDa. Function: Binds galactosides Subcellular Location: Cytoplasm, Nucleus, Secreted. Tissue Specificity: Peripheral blood leukocytes and lymphatic tissues. Expressed in lung, liver, breast and kidney with higher levels in tumor endothelial cells than normal endothelium (at protein level) (PubMed:24333696). Expressed in trophoblast cells in decidua and placenta in pregnancy (at protein level) (PubMed:23242525, PubMed:25578313). Isoform 2 is the most abundant isoform expressed in endothelial cells (PubMed:24333696). Upon endothelial cell activation isoform 2 expression decreases while expression of isoform 3 and isoform 5 increases (PubMed:24333696). Isoform 4 decreases in pathological pregnancy (PubMed:23242525).

• Artikelnummer: CSB-EP012895HU-100
• Hersteller: Cusabio
• Hersteller Artikelnummer: CSB-EP012895HU-100
• Green Labware: Nein
• Verpackungseinheit: 100 µg
• Mengeneinheit: STK
• Reaktivität: Human
• Methode: Sodium Dodecyl Sulfate Polyacrylamide Gel Electrophoresis (SDS-PAGE)
• Wirt: Escherichia Coli