Purity: Greater than 90% as determined by SDS-PAGE.
Species: Homo sapiens (Human).
Source: E.coli.
Expression Region: 60-195aa.
Molecular Weight: 31.5kDa.
Tag Info: N-terminal 6xHis-SUMO-tagged.
Form: Liquid or Lyophilized powder.
Target Protein Sequence: LCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKCPFADQALF.
Organism: Homo sapiens (Human). Function: Plays an inhibitory role on natural killer (NK) cells and T-cell functions upon binding to their non-MHC ligands. May mediate missing self recognition by binding to a highly conserved site on classical cadherins, enabling it to monitor expression of E-cadherin/CDH1, N-cadherin/CDH2 and R-cadherin/CDH4 on target cells. Subcellular Location: Cell membrane, Single-pass type II membrane protein. Tissue Specificity: Expressed specifically on natural killer (NK) cells and T-cells, mainly CD8 T-cells. Tag Info: N-terminal 6xHis-SUMO-tagged