Recombinant Human Myeloid cell surface antigen CD33 (CD33), partial

Recombinant Human Myeloid cell surface antigen CD33 (CD33), partial
Artikelnummer
CSB-EP004925HU-1
Verpackungseinheit
1 mg
Hersteller
Cusabio

Verfügbarkeit: wird geladen...
Preis wird geladen...
Purity: Greater than 85% as determined by SDS-PAGE.

Species: Homo sapiens (Human).

Source: E.coli.

Expression Region: 48-259aa.

Molecular Weight: 46.7 kDa.

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged.

Form: Liquid or Lyophilized powder.

Target Protein Sequence: DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH.



Organism: Homo sapiens (Human) . Function: Putative adhesion molecule of myelomonocytic-derived cells that mediates sialic-acid dependent binding to cells. Preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules. Induces apoptosis in acute myeloid leukemia (in vitro). Subcellular Location: Cell membrane, Single-pass type I membrane protein. Protein Families: Immunoglobulin superfamily, SIGLEC (sialic acid binding Ig-like lectin) family. Tissue Specificity: Monocytic/myeloid lineage cells. Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Mehr Informationen
Artikelnummer CSB-EP004925HU-1
Hersteller Cusabio
Hersteller Artikelnummer CSB-EP004925HU-1
Green Labware Nein
Verpackungseinheit 1 mg
Mengeneinheit STK
Wirt Escherichia Coli
Produktinformation (PDF) Download
MSDS (PDF)
×