English
Recombinant Human Secretory phospholipase A2 receptor (PLA2R1), partial
Recombinant Human Secretory phospholipase A2 receptor (PLA2R1), partial
Artikelnummer
CSB-EP623780HU-1
Verpackungseinheit
1 mg
Hersteller
Cusabio
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Purity: Greater than 90% as determined by SDS-PAGE.
Species: Homo sapiens (Human).
Source: E.coli.
Expression Region: 395-530aa.
Molecular Weight: 19.4kDa.
Tag Info: N-terminal 6xHis-tagged.
Form: Liquid or Lyophilized powder.
Target Protein Sequence: EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID.
Organism: Homo sapiens (Human). Function: Receptor for secretory phospholipase A2 (sPLA2). Acts as a receptor for phosholipase sPLA2-IB/PLA2G1B but not sPLA2-IIA/PLA2G2A. Also able to bind to snake PA2-like toxins. Although its precise function remains unclear, binding of sPLA2 to its receptor participates in both positive and negative regulation of sPLA2 functions as well as clearance of sPLA2. Binding of sPLA2-IB/PLA2G1B induces various effects depending on the cell type, such as activation of the mitogen-activated protein kinase (MAPK) cascade to induce cell proliferation, the production of lipid mediators, selective release of arachidonic acid in bone marrow-derived mast cells. In neutrophils, binding of sPLA2-IB/PLA2G1B can activate p38 MAPK to stimulate elastase release and cell adhesion. May be involved in responses in proinflammatory cytokine productions during endotoxic shock. Also has endocytic properties and rapidly internalizes sPLA2 ligands, which is particularly important for the clearance of extracellular sPLA2s to protect their potent enzymatic activities. The soluble secretory phospholipase A2 receptor form is circulating and acts as a negative regulator of sPLA2 functions by blocking the biological functions of sPLA2-IB/PLA2G1B. Subcellular Location: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Soluble secretory phospholipase A2 receptor: Secreted, SUBCELLULAR LOCATION: Isoform 2: Secreted. Tissue Specificity: Present in lung macrophage (at protein level). Highly expressed in kidney. Also expressed in pancreas, amnion, choriodecidua and placenta. Isoform 2 is expressed at much lower level. Tag Info: N-terminal 6xHis-tagged
Species: Homo sapiens (Human).
Source: E.coli.
Expression Region: 395-530aa.
Molecular Weight: 19.4kDa.
Tag Info: N-terminal 6xHis-tagged.
Form: Liquid or Lyophilized powder.
Target Protein Sequence: EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID.
Organism: Homo sapiens (Human). Function: Receptor for secretory phospholipase A2 (sPLA2). Acts as a receptor for phosholipase sPLA2-IB/PLA2G1B but not sPLA2-IIA/PLA2G2A. Also able to bind to snake PA2-like toxins. Although its precise function remains unclear, binding of sPLA2 to its receptor participates in both positive and negative regulation of sPLA2 functions as well as clearance of sPLA2. Binding of sPLA2-IB/PLA2G1B induces various effects depending on the cell type, such as activation of the mitogen-activated protein kinase (MAPK) cascade to induce cell proliferation, the production of lipid mediators, selective release of arachidonic acid in bone marrow-derived mast cells. In neutrophils, binding of sPLA2-IB/PLA2G1B can activate p38 MAPK to stimulate elastase release and cell adhesion. May be involved in responses in proinflammatory cytokine productions during endotoxic shock. Also has endocytic properties and rapidly internalizes sPLA2 ligands, which is particularly important for the clearance of extracellular sPLA2s to protect their potent enzymatic activities. The soluble secretory phospholipase A2 receptor form is circulating and acts as a negative regulator of sPLA2 functions by blocking the biological functions of sPLA2-IB/PLA2G1B. Subcellular Location: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Soluble secretory phospholipase A2 receptor: Secreted, SUBCELLULAR LOCATION: Isoform 2: Secreted. Tissue Specificity: Present in lung macrophage (at protein level). Highly expressed in kidney. Also expressed in pancreas, amnion, choriodecidua and placenta. Isoform 2 is expressed at much lower level. Tag Info: N-terminal 6xHis-tagged
| Artikelnummer | CSB-EP623780HU-1 |
|---|---|
| Hersteller | Cusabio |
| Hersteller Artikelnummer | CSB-EP623780HU-1 |
| Green Labware | Nein |
| Verpackungseinheit | 1 mg |
| Mengeneinheit | STK |
| Reaktivität | Human |
| Methode | Sodium Dodecyl Sulfate Polyacrylamide Gel Electrophoresis (SDS-PAGE) |
| Wirt | Escherichia Coli |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
Laurent Haze
