Recombinant Mouse Asialoglycoprotein receptor 2 (Asgr2), partial

Purity: Greater than 85% as determined by SDS-PAGE.

Species: Mus musculus (Mouse).

Source: E.coli.

Expression Region: 80-301aa.

Molecular Weight: 29.9 kDa.

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged.

Form: Liquid or Lyophilized powder.

Target Protein Sequence: QSIQLQEEFRTLKETFSNFSSSTLMEFGALDTLGGSTNAILTSWLAQLEEKQQQLKADHSTLLFHLKHFPMDLRTLTCQLAYFQSNGTECCPVNWVEFGGSCYWFSRDGLTWAEADQYCQLENAHLLVINSREEQDFVVKHRSQFHIWIGLTDRDGSWKWVDGTDYRSNYRNWAFTQPDNWQGHEQGGGEDCAEILSDGHWNDNFCQQVNRWVCEKRRNITH.



Organism: Mus musculus (Mouse). Function: Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell membrane surface. Subcellular Location: Membrane, Single-pass type II membrane protein. Tissue Specificity: Expressed exclusively in hepatic parenchymal cells. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

• Artikelnummer: CSB-EP002208MO1-100
• Hersteller: Cusabio
• Hersteller Artikelnummer: CSB-EP002208MO1-100
• Green Labware: Nein
• Verpackungseinheit: 100 µg
• Mengeneinheit: STK
• Wirt: Escherichia Coli