English
Recombinant Mouse Asialoglycoprotein receptor 2 (Asgr2), partial
Recombinant Mouse Asialoglycoprotein receptor 2 (Asgr2), partial
Artikelnummer
CSB-EP002208MO1b3-100
Verpackungseinheit
100 µg
Hersteller
Cusabio
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Purity: Greater than 90% as determined by SDS-PAGE.
Species: Mus musculus (Mouse).
Source: E.coli.
Expression Region: 80-301aa.
Molecular Weight: 45.9kDa.
Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged.
Form: Liquid or Lyophilized powder.
Target Protein Sequence: QSIQLQEEFRTLKETFSNFSSSTLMEFGALDTLGGSTNAILTSWLAQLEEKQQQLKADHSTLLFHLKHFPMDLRTLTCQLAYFQSNGTECCPVNWVEFGGSCYWFSRDGLTWAEADQYCQLENAHLLVINSREEQDFVVKHRSQFHIWIGLTDRDGSWKWVDGTDYRSNYRNWAFTQPDNWQGHEQGGGEDCAEILSDGHWNDNFCQQVNRWVCEKRRNITH.
Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged. MW: 45.9 kDa. Function: Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell membrane surface. Subcellular Location: Membrane, Single-pass type II membrane protein. Tissue Specificity: Expressed exclusively in hepatic parenchymal cells.
Species: Mus musculus (Mouse).
Source: E.coli.
Expression Region: 80-301aa.
Molecular Weight: 45.9kDa.
Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged.
Form: Liquid or Lyophilized powder.
Target Protein Sequence: QSIQLQEEFRTLKETFSNFSSSTLMEFGALDTLGGSTNAILTSWLAQLEEKQQQLKADHSTLLFHLKHFPMDLRTLTCQLAYFQSNGTECCPVNWVEFGGSCYWFSRDGLTWAEADQYCQLENAHLLVINSREEQDFVVKHRSQFHIWIGLTDRDGSWKWVDGTDYRSNYRNWAFTQPDNWQGHEQGGGEDCAEILSDGHWNDNFCQQVNRWVCEKRRNITH.
Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged. MW: 45.9 kDa. Function: Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell membrane surface. Subcellular Location: Membrane, Single-pass type II membrane protein. Tissue Specificity: Expressed exclusively in hepatic parenchymal cells.
| Artikelnummer | CSB-EP002208MO1b3-100 |
|---|---|
| Hersteller | Cusabio |
| Hersteller Artikelnummer | CSB-EP002208MO1B3-100 |
| Green Labware | Nein |
| Verpackungseinheit | 100 µg |
| Mengeneinheit | STK |
| Reaktivität | Mouse (Murine) |
| Methode | Sodium Dodecyl Sulfate Polyacrylamide Gel Electrophoresis (SDS-PAGE) |
| Wirt | Escherichia Coli |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
Laurent Haze
