English
Recombinant Mouse C-type lectin domain family 4 member A (Clec4a), partial
Recombinant Mouse C-type lectin domain family 4 member A (Clec4a), partial
Artikelnummer
CSB-EP874136MO-100
Verpackungseinheit
100 µg
Hersteller
Cusabio
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Purity: Greater than 90% as determined by SDS-PAGE.
Species: Mus musculus (Mouse).
Source: E.coli.
Expression Region: 70-238aa.
Molecular Weight: 39.6kDa.
Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged.
Form: Liquid or Lyophilized powder.
Target Protein Sequence: QKYSQLLEEKKAAKNIMHNELNCTKSVSPMEDKVWSCCPKDWRLFGSHCYLVPTVSSSASWNKSEENCSRMGAHLVVIQSQEEQDFITGILDTHAAYFIGLWDTGHRQWQWVDQTPYEESITFWHNGEPSSGNEKCATIIYRWKTGWGWNDISCSLKQKSVCQMKKINL.
Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged. MW: 39.6 kDa. Function: May be involved in regulating immune reactivity. May play a role in modulating dendritic cells (DC) differentiation and/or maturation (By similarity). May be involved in the inhibition of B-cell-receptor-mediated calcium mobilization and protein tyrosine phosphorylation. Subcellular Location: Membrane, Single-pass type II membrane protein. Tissue Specificity: Expressed in splenic antigen-presenting cells including B-cells, monocytes/macrophages, and dendritic cells (at protein level). Expressed in spleen and lymph node and slightly increased with dendritic cell maturation.
Species: Mus musculus (Mouse).
Source: E.coli.
Expression Region: 70-238aa.
Molecular Weight: 39.6kDa.
Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged.
Form: Liquid or Lyophilized powder.
Target Protein Sequence: QKYSQLLEEKKAAKNIMHNELNCTKSVSPMEDKVWSCCPKDWRLFGSHCYLVPTVSSSASWNKSEENCSRMGAHLVVIQSQEEQDFITGILDTHAAYFIGLWDTGHRQWQWVDQTPYEESITFWHNGEPSSGNEKCATIIYRWKTGWGWNDISCSLKQKSVCQMKKINL.
Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged. MW: 39.6 kDa. Function: May be involved in regulating immune reactivity. May play a role in modulating dendritic cells (DC) differentiation and/or maturation (By similarity). May be involved in the inhibition of B-cell-receptor-mediated calcium mobilization and protein tyrosine phosphorylation. Subcellular Location: Membrane, Single-pass type II membrane protein. Tissue Specificity: Expressed in splenic antigen-presenting cells including B-cells, monocytes/macrophages, and dendritic cells (at protein level). Expressed in spleen and lymph node and slightly increased with dendritic cell maturation.
| Artikelnummer | CSB-EP874136MO-100 |
|---|---|
| Hersteller | Cusabio |
| Hersteller Artikelnummer | CSB-EP874136MO-100 |
| Green Labware | Nein |
| Verpackungseinheit | 100 µg |
| Mengeneinheit | STK |
| Reaktivität | Mouse (Murine) |
| Methode | Sodium Dodecyl Sulfate Polyacrylamide Gel Electrophoresis (SDS-PAGE) |
| Wirt | Escherichia Coli |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
Laurent Haze
