Recombinant Mouse C-type lectin domain family 4 member E (Clec4e), partial

Purity: Greater than 90% as determined by SDS-PAGE.

Species: Mus musculus (Mouse).

Source: E.coli.

Expression Region: 46-214aa.

Molecular Weight: 23.6kDa.

Tag Info: N-terminal 6xHis-tagged.

Form: Liquid or Lyophilized powder.

Target Protein Sequence: TYRSSQISGQNLQPHRNIKELSCYSEASGSVKNCCPLNWKHYQSSCYFFSTTTLTWSSSLKNCSDMGAHLVVIDTQEEQEFLFRTKPKRKEFYIGLTDQVVEGQWQWVDDTPFTESLSFWDAGEPNNIVLVEDCATIRDSSNSRKNWNDIPCFYSMPWICEMPEISPLD.



Organism: Mus musculus (Mouse). Function: C-type lectin that functions as cell-surface receptor for a wide variety of ligands such as damaged cells, fungi and mycobacteria. Plays a role in the recognition of pathogenic fungi, such as Candida albicans. The detection of mycobacteria is via trehalose 6,6'-dimycolate (TDM), a cell wall glycolipid. Specifically recognizes alpha-mannose residues on pathogenic fungi of the genus Malassezia. Recognizes also SAP130, a nuclear protein, that is released by dead or dying cells. Transduces signals through an ITAM-containing adapter protein, Fc receptor gamma chain /FCER1G. Induces secretion of inflammatory cytokines through a pathway that depends on SYK, CARD9 and NF-kappa-B. Subcellular Location: Membrane, Single-pass type II membrane protein. Tissue Specificity: Expressions were observed in peritoneal macrophage, macrophage cell line RAW 264.7, and myeloblastic leukemia cell line M1 following inflammatory stimuli. Tag Info: N-terminal 6xHis-tagged

• Artikelnummer: CSB-EP870809MO-100
• Hersteller: Cusabio
• Hersteller Artikelnummer: CSB-EP870809MO-100
• Green Labware: Nein
• Verpackungseinheit: 100 µg
• Mengeneinheit: STK
• Reaktivität: Mouse (Murine)
• Methode: Sodium Dodecyl Sulfate Polyacrylamide Gel Electrophoresis (SDS-PAGE)
• Wirt: Escherichia Coli