Research Areas: Tags & Cell Markers
Uniprot: Q8K419
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Form: Liquid or Lyophilized powder
Tag Info: N-terminal 6xHis-tagged
Purity: Greater than 90% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Molecular Weight: 38.4 kDa
Gene Names: Lgals4
Organism: Mus musculus (Mouse)
Source: Yeast
Expression Region: 1-326aa
Protein Length: Full Length
Target Protein Sequence: MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSVYIQGMAKENMRRFHVNFAVGQDDGADVAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGKHFELVFMVMPEHYKVVVNGNSFYEYGHRLPVQMVTHLQVDGDLELQSINFLGGQPAAAPYPGAMTIPAYPAGSPGYNPPQMNTLPVMTGPPVFNPRVPYVGALQGGLTVRRTIIIKGYVLPTARNFVINFKVGSSGDIALHLNPRIGDSVVRNSFMNGSWGAEERKVAYNPFGPGQFFDLSIRCGMDRFKVFANGQHLFDFSHRFQAFQMVDTLEINGDITLSYVQI
Endotoxin: Not test.
Relevance: Galectin that binds lactose and a related range of sugars.
Reference: "Crystal structure of the N-terminal domain of mouse galectin-4."RIKEN structural genomics initiative (RSGI)Submitted (OCT-2007)
Function: Galectin that binds lactose and a related range of sugars.
Deutsch
English
