Recombinant Rana japonica Sialic acid-binding lectin

Purity: Greater than 90% as determined by SDS-PAGE.

Species: Rana japonica (Japanese reddish frog).

Source: E.coli.

Expression Region: 1-111aa.

Molecular Weight: 16.3kDa.

Tag Info: N-terminal 6xHis-tagged.

Form: Liquid or Lyophilized powder.

Target Protein Sequence: QNWAKFQEKHIPNTSNINCNTIMDKSIYIVGGQCKERNTFIISSATTVKAICSGASTNRNVLSTTRFQLNTCIRSATAPRPCPYNSRTETNVICVKCENRLPVHFAGIGRC.



Organism: Rana japonica (Japanese reddish frog). Function: The S-lectins in frog eggs may be involved in the fertilization and development of the frog embryo. This lectin preferentially agglutinate a large variety of tumor cells, but it does not agglutinate non-transformed cells and erythrocytes. Subcellular Location: Secreted. Protein Families: Pancreatic ribonuclease family. Tag Info: N-terminal 6xHis-tagged

• Artikelnummer: CSB-EP321644RJL-1
• Hersteller: Cusabio
• Hersteller Artikelnummer: CSB-EP321644RJL-1
• Green Labware: Nein
• Verpackungseinheit: 1 mg
• Mengeneinheit: STK
• Reaktivität: R. japonica
• Methode: Sodium Dodecyl Sulfate Polyacrylamide Gel Electrophoresis (SDS-PAGE)
• Wirt: Escherichia Coli