Research Areas: Neuroscience
Uniprot: P08699
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Form: Liquid or Lyophilized powder
Tag Info: N-terminal 6xHis-tagged
Purity: Greater than 85% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Molecular Weight: 31.1 kDa
Gene Names: Lgals3
Organism: Rattus norvegicus (Rat)
Source: E.coli
Expression Region: 2-262aa
Protein Length: Full Length of Mature Protein
Target Protein Sequence: ADGFSLNDALAGSGNPNPQGWPGAWGNQPGAGGYPGASYPGAYPGQAPPGGYPGQAPPSAYPGPTGPSAYPGPTAPGAYPGPTAPGAFPGQPGGPGAYPSAPGAYPSAPGAYPATGPFGAPTGPLTVPYDMPLPGGVMPRMLITIIGTVKPNANSITLNFKKGNDIAFHFNPRFNENNRRVIVCNTKQDNNWGREERQSAFPFESGKPFKIQVLVEADHFKVAVNDVHLLQYNHRMKNLREISQLGIIGDITLTSASHAMI
Endotoxin: Not test.
Relevance: Galactose-specific lectin which binds IgE. May mediate with the alpha-3, beta-1 integrin the stimulation by CSPG4 of endothelial cells migration. In the nucleus: acts as a pre-mRNA splicing factor. Involved in acute inflammatory responses including neutrophil activation and adhesion, chemoattraction of monocytes macrophages, opsonization of apoptotic neutrophils, and activation of mast cells. Together with DMBT1, required for terminal differentiation of columnar epithelial cells during early embryogenesis.
Reference: "An IgE-binding protein with a distinctive repetitive sequence and homology with an IgG receptor."Albrandt K., Orida N.K., Liu F.-T.Proc. Natl. Acad. Sci. U.S.A. 84:6859-6863(1987)
Function: Galactose-specific lectin which binds IgE. May mediate with the alpha-3, beta-1 integrin the stimulation by CSPG4 of endothelial cells migration. In the nucleus
Deutsch
English
