Recombinant Tachypleus tridentatus Tachylectin-2

Recombinant Tachypleus tridentatus Tachylectin-2
Artikelnummer
CSB-EP634622TAH-1
Verpackungseinheit
1 mg
Hersteller
Cusabio

Verfügbarkeit: wird geladen...
Preis wird geladen...
Research Areas: Others

Uniprot: Q27084

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Form: Liquid or Lyophilized powder

Tag Info: N-terminal 6xHis-SUMO-tagged

Purity: Greater than 90% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 42.8 kDa

Gene Names: N/A

Organism: Tachypleus tridentatus (Japanese horseshoe crab)

Source: E.coli

Expression Region: 20-255aa

Protein Length: Full Length of Mature Protein

Target Protein Sequence: VGGESMLRGVYQDKFYQGTYPQNKNDNWLARATLIGKGGWSNFKFLFLSPGGELYGVLNDKIYKGTPPTHDNDNWMGRAKKIGNGGWNQFQFLFFDPNGYLYAVSKDKLYKASPPQSDTDNWIARATEIGSGGWSGFKFLFFHPNGYLYAVHGQQFYKALPPVSNQDNWLARATKIGQGGWDTFKFLFFSSVGTLFGVQGGKFYEDYPPSYAHDNWLARAKLIGNGGWDDFRFLFF

Endotoxin: Not test.

Relevance: Lectin that binds specifically to N-acetylglucosamine and N-acetylgalactosamine. Is part of the innate immunity host defense system of the horseshoe crab.

Reference: "Purification, characterization, and cDNA cloning of a 27-KDA lectin (L10) from horseshoe crab hemocytes."Okino N., Kawabata S., Saito T., Hirata M., Takagi T., Iwanaga S.J. Biol. Chem. 270:31008-31015(1995)

Function: Lectin that binds specifically to N-acetylglucosamine and N-acetylgalactosamine. Is part of the innate immunity host defense system of the horseshoe crab.
Mehr Informationen
Artikelnummer CSB-EP634622TAH-1
Hersteller Cusabio
Hersteller Artikelnummer CSB-EP634622TAH-1
Verpackungseinheit 1 mg
Mengeneinheit STK
Reaktivität Various species
Methode SDS-PAGE
Wirt Escherichia Coli
Produktinformation (PDF) Download
MSDS (PDF) Download