Recombinant Tachypleus tridentatus Tachylectin-2

Purity: Greater than 90% as determined by SDS-PAGE.

Species: Tachypleus tridentatus (Japanese horseshoe crab).

Source: E.coli.

Expression Region: 20-255aa.

Molecular Weight: 42.8kDa.

Tag Info: N-terminal 6xHis-SUMO-tagged.

Form: Liquid or Lyophilized powder.

Target Protein Sequence: VGGESMLRGVYQDKFYQGTYPQNKNDNWLARATLIGKGGWSNFKFLFLSPGGELYGVLNDKIYKGTPPTHDNDNWMGRAKKIGNGGWNQFQFLFFDPNGYLYAVSKDKLYKASPPQSDTDNWIARATEIGSGGWSGFKFLFFHPNGYLYAVHGQQFYKALPPVSNQDNWLARATKIGQGGWDTFKFLFFSSVGTLFGVQGGKFYEDYPPSYAHDNWLARAKLIGNGGWDDFRFLFF.



Organism: Tachypleus tridentatus (Japanese horseshoe crab). Function: Lectin that binds specifically to N-acetylglucosamine and N-acetylgalactosamine. Is part of the innate immunity host defense system of the horseshoe crab. Subcellular Location: Secreted, Cytoplasmic granule. Tag Info: N-terminal 6xHis-SUMO-tagged

• Artikelnummer: CSB-EP634622TAH-1
• Hersteller: Cusabio
• Hersteller Artikelnummer: CSB-EP634622TAH-1
• Green Labware: Nein
• Verpackungseinheit: 1 mg
• Mengeneinheit: STK
• Reaktivität: Crab
• Methode: Sodium Dodecyl Sulfate Polyacrylamide Gel Electrophoresis (SDS-PAGE)
• Wirt: Escherichia Coli