Recombinant Viscum album Beta-galactoside-specific lectin 1, partial

Recombinant Viscum album Beta-galactoside-specific lectin 1, partial
Artikelnummer
CSB-YP305846VDOA4-100
Verpackungseinheit
100 µg
Hersteller
Cusabio

Verfügbarkeit: wird geladen...
Preis wird geladen...
Research Areas: Others

Uniprot: P81446

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Form: Liquid or Lyophilized powder

Tag Info: N-terminal 6xHis-sumostar-tagged

Purity: Greater than 85% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 44.4 kDa

Gene Names: N/A

Organism: Viscum album (European mistletoe)

Source: Yeast

Expression Region: 34-287aa

Protein Length: Partial

Target Protein Sequence: YERLRLRVTHQTTGEEYFRFITLLRDYVSSGSFSNEIPLLRQSTIPVSDAQRFVLVELTNEGGDSITAAIDVTNLYVVAYQAGDQSYFLRDAPRGAETHLFTGTTRSSLPFNGSYPDLERYAGHRDQIPLGIDQLIQSVTALRFPGGSTRTQARSILILIQMISEAARFNPILWRARQYINSGASFLPDVYMLELETSWGQQSTQVQQSTDGVFNNPIRLAIPPGNFVTLTNVRDVIASLAIMLFVCGERPSSS

Endotoxin: Not test.

Relevance: The A chain is responsible for inhibiting protein synthesis through the catalytic inactivation of 60S ribosomal subunits by removing adenine from position 4,324 of 28S rRNA. The B chain binds to cell receptors and probably facilitates the entry into the cell of the A chain; B chains are also responsible for cell agglutination (lectin activity). Inhibits growth of the human tumor cell line Molt4.

Reference: "Purification and characterization of four isoforms of Himalayan mistletoe ribosome-inactivating protein from Viscum album having unique sugar affinity."Mishra V., Sharma R.S., Yadav S., Babu C.R., Singh T.P.Arch. Biochem. Biophys. 423:288-301(2004)

Function: The A chain is responsible for inhibiting protein synthesis through the catalytic inactivation of 60S ribosomal subunits by removing adenine from position 4,324 of 28S rRNA. The B chain binds to cell receptors and probably facilitates the entry into the cell of the A chain; B chains are also responsible for cell agglutination (lectin activity). Inhibits growth of the human tumor cell line Molt4.
Mehr Informationen
Artikelnummer CSB-YP305846VDOA4-100
Hersteller Cusabio
Hersteller Artikelnummer CSB-YP305846VDOA4-100
Verpackungseinheit 100 µg
Mengeneinheit STK
Methode SDS-PAGE
Wirt Yeast
Produktinformation (PDF) Download
MSDS (PDF) Download