Research Areas: Metabolism
Uniprot: P29203
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Form: Liquid or Lyophilized powder
Tag Info: N-terminal hFc-tagged
Purity: Greater than 95% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Molecular Weight: 30.5 kDa
Gene Names: PYY
Organism: Gallus gallus (Chicken)
Source: Yeast
Expression Region: 1-37aa
Protein Length: Full Length
Target Protein Sequence: AYPPKPESPGDAASPEEIAQYFSALRHYINLVTRQRY
Endotoxin: Not test.
Relevance: This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility.