Recombinant Mouse Dickkopf-related protein 2 (Dkk2)

Recombinant Mouse Dickkopf-related protein 2 (Dkk2)
Artikelnummer
CSB-EP865601MO-1
Verpackungseinheit
1 mg
Hersteller
Cusabio

Verfügbarkeit: wird geladen...
Preis wird geladen...
Research Areas: Others

Uniprot: Q9QYZ8

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Form: Liquid or Lyophilized powder

Tag Info: C-terminal 6xHis-tagged

Purity: Greater than 85% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 31.8 kDa

Gene Names: Dkk2

Organism: Mus musculus (Mouse)

Source: E.coli

Expression Region: 34-259aa

Protein Length: Full Length of Mature Protein

Target Protein Sequence: KLNSIKSSLGGETPAQSANRSAGMNQGLAFGGSKKGKSLGQAYPCSSDKECEVGRYCHSPHQGSSACMLCRRKKKRCHRDGMCCPGTRCNNGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHSKMPHIKGHEGDPCLRSSDCIDGFCCARHFWTKICKPVLHQGEVCTKQRKKGSHGLEIFQRCDCAKGLSCKVWKDATYSSKARLHVCQKI

Endotoxin: Not test.

Relevance: Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease.
Mehr Informationen
Artikelnummer CSB-EP865601MO-1
Hersteller Cusabio
Hersteller Artikelnummer CSB-EP865601MO-1
Verpackungseinheit 1 mg
Mengeneinheit STK
Produktinformation (PDF) Download
MSDS (PDF) Download