Anti-CBL Magnetic Beads

Uniprot: P22681

Gene Name: CBL

Purity: ≥85%

Formulation: Supplied as solution in phosphate buffered saline containing 0.01% BSA and 0.02% sodium azide

Core Sequence: KPLPVPPTLRDLPPPPPPDRPYSVGAESRPQRRPLPCTPGDCPSRDKLPPVPSSRLGDSWLPRPIPKVPVSAPSSSDPWT

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 90%, Pig - 89%, Cynomolgus monkey - 99%

Alternative gene names: CBL2; RNF55

Alternative protein names: E3 ubiquitin-protein ligase CBL; Casitas B-lineage lymphoma proto-oncogene; Proto-oncogene c-Cbl; RING finger protein 55; RING-type E3 ubiquitin transferase CBL; Signal transduction protein CBL

Protein name: Cbl proto-oncogene

Product panel: E3 Ligase

Antigen Species: Human

Target Name: CBL

IP Dilution: 1:5

Antigen ID: PP-1296

Bead diameter: 0.5 μm

• Artikelnummer: ASBMB-043-5
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: MB-043-5
• Verpackungseinheit: 5 ml
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Monoclonal
• Methode: Immunoprecipitation
• Isotyp: IgG1
• Human Gene ID: 867
• Wirt: Mouse