Anti-DTX2 Magnetic Beads

Uniprot: Q86UW9

Gene Name: DTX2

Purity: ≥85%

Formulation: Supplied as solution in phosphate buffered saline containing 0.01% BSA and 0.02% sodium azide

Core Sequence: HGSVKRLRKMSVKGATPKPEPEPEQVIKNYTEELKVPPDEDCIICMEKLSTASGYSDVTDSKAIGSLAVGHLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKTIYGEKTGTQPQGKMEVLRFQMSLPGHEDCGTILIVYSIPHGIQGPEHPNPGKPFTARGFPRQCYLPDNAQGRKVLELLKVAWKRRLIFTVGTSSTTGETDTVVWNEIHHKTEMDRNITGHGYPDPNYLQNVLAELA

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 90%, Pig - 92%, Cynomolgus monkey - 96%

Alternative gene names: KIAA1528; RNF58

Alternative protein names: Probable E3 ubiquitin-protein ligase DTX2; Protein deltex-2; Deltex2; hDTX2; RING finger protein 58; RING-type E3 ubiquitin transferase DTX2

Protein name: Deltex E3 ubiquitin ligase 2

Product panel: E3 Ligase

Antigen Species: Human

Target Name: DTX2

IP Dilution: 1:5

Antigen ID: PP-6420

Bead diameter: 0.5 μm

• Artikelnummer: ASBMB-037-5
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: MB-037-5
• Verpackungseinheit: 5 ml
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Monoclonal
• Methode: Immunoprecipitation
• Isotyp: IgG1
• Human Gene ID: 113878
• Wirt: Mouse