Anti-NEDD4 Magnetic Beads

Uniprot: P46934

Gene Name: NEDD4

Purity: ≥85%

Formulation: Supplied as solution in phosphate buffered saline containing 0.01% BSA and 0.02% sodium azide

Core Sequence: NARLTIFGNSAVSQPASSSNHSSRRGSLQAYTFEEQPTLPVLLPTSSGLPPGWEEKQDERGRSYYVDHNSRTTTWTKPTVQATVETSQLTSSQSSAGPQSQASTSDSGQQ

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 80%, Rat - 80%, Pig - 80%, Cynomolgus monkey - 97%

Alternative gene names: KIAA0093; NEDD4-1; RPF1

Alternative protein names: E3 ubiquitin-protein ligase NEDD4; Cell proliferation-inducing gene 53 protein; HECT-type E3 ubiquitin transferase NEDD4; Neural precursor cell expressed developmentally down-regulated protein 4; NEDD-4

Protein name: NEDD4 E3 ubiquitin protein ligase

Product panel: E3 Ligase

Antigen Species: Human

Target Name: NEDD4

IP Dilution: 1:5

Antigen ID: PP-10544

Bead diameter: 0.5 μm

• Artikelnummer: ASBMB-009-5
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: MB-009-5
• Verpackungseinheit: 5 ml
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Monoclonal
• Methode: Immunoprecipitation
• Isotyp: IgG1
• Human Gene ID: 4734
• Wirt: Mouse