Anti-PML Magnetic Beads

Uniprot: P29590

Gene Name: PML

Purity: ≥85%

Formulation: Supplied as solution in phosphate buffered saline containing 0.01% BSA and 0.02% sodium azide

Core Sequence: EAERVKAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSYGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENLADPQAEDRPLVFFDLKIDNETQKISQLAAV

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 67%, Pig - 71%, Cynomolgus monkey - 95%

Alternative gene names: MYL; PP8675; RNF71; TRIM19

Alternative protein names: Protein PML; E3 SUMO-protein ligase PML; Promyelocytic leukemia protein; RING finger protein 71; RING-type E3 SUMO transferase PML; Tripartite motif-containing protein 19; TRIM19

Protein name: PML nuclear body scaffold

Product panel: E3 Ligase

Antigen Species: Human

Target Name: PML

IP Dilution: 1:5

Antigen ID: PP-4826

Bead diameter: 0.5 μm

• Artikelnummer: ASBMB-004-1
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: MB-004-1
• Verpackungseinheit: 1 ml
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Monoclonal
• Methode: Immunoprecipitation
• Isotyp: IgG1
• Human Gene ID: 5371
• Wirt: Mouse