Anti-RNF32 Magnetic Beads

Uniprot: Q9H0A6

Gene Name: RNF32

Purity: ≥85%

Formulation: Supplied as solution in phosphate buffered saline containing 0.01% BSA and 0.02% sodium azide

Core Sequence: KDNLAVNAVALQDHILHDLQLRNLSVADHSKTQVQKKENKSLKRDTKAIIDTGLKKTTQCPKLEDSEKEYVLDPKPPPLTLAQKLGLIGPPPPPLSSDEW

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 71%

Alternative gene names: /

Alternative protein names: RING finger protein 32

Protein name: Ring finger protein 32

Product panel: E3 Ligase

Antigen Species: Human

Target Name: RNF32

IP Dilution: 1:5

Antigen ID: PP-8256

Bead diameter: 0.5 μm

• Artikelnummer: ASBMB-047-5
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: MB-047-5
• Verpackungseinheit: 5 ml
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Monoclonal
• Methode: Immunoprecipitation
• Isotyp: IgG1
• Human Gene ID: 140545
• Wirt: Mouse