Anti-SH3RF1 Magnetic Beads

Uniprot: Q7Z6J0

Gene Name: SH3RF1

Purity: ≥85%

Formulation: Supplied as solution in phosphate buffered saline containing 0.01% BSA and 0.02% sodium azide

Core Sequence: GNSSATKPDKDSKKEKKGLLKLLSGASTKRKPRVSPPASPTLEVELGSAELPLQGAVGPELPPGGGHGRAGSCPVDGDGPVTTAVAGAALAQDAFHRKASSLDSAVPIAPPPRQACSSLGPVLNESRPVVCERHRVVVSYPPQSEAELELKEGDIVFVHKKREDGWFKGTLQRNGKTGLF

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 91%, Rat - 92%, Pig - 69%, Cynomolgus monkey - 99%

Alternative gene names: KIAA1494; POSH; POSH1; RNF142; SH3MD2

Alternative protein names: E3 ubiquitin-protein ligase SH3RF1; Plenty of SH3s; Protein POSH; RING finger protein 142; RING-type E3 ubiquitin transferase SH3RF1; SH3 domain-containing RING finger protein 1; SH3 multiple domains protein 2

Protein name: SH3 domain containing ring finger 1

Product panel: E3 Ligase

Antigen Species: Human

Target Name: SH3RF1

IP Dilution: 1:5

Antigen ID: PP-5179

Bead diameter: 0.5 μm

• Artikelnummer: ASBMB-049-1
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: MB-049-1
• Verpackungseinheit: 1 ml
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine)
• Klonalität: Monoclonal
• Methode: Immunoprecipitation
• Isotyp: IgG1
• Human Gene ID: 57630
• Wirt: Mouse