Anti-SHPRH Magnetic Beads

Uniprot: Q149N8

Gene Name: SHPRH

Purity: ≥85%

Formulation: Supplied as solution in phosphate buffered saline containing 0.01% BSA and 0.02% sodium azide

Core Sequence: DKTKKQAVGSPRKIQKETRKSGNKDTDSEYLPSDTSDDDDDPYYYYYKSRRNRSKLRKKLVPSTKKGKSQPFINPDSQGHCPATSDSGITDVAMSKSTCISEFNQEHETEDCAESLNHADSDVPPSNTMSPFNTSDYRFECICGELDQIDRKPRVQCLKCHLWQHAKCVN

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 67%, Pig - 76%, Cynomolgus monkey - 93%

Alternative gene names: KIAA2023

Alternative protein names: E3 ubiquitin-protein ligase SHPRH; RING-type E3 ubiquitin transferase SHPRH; SNF2; histone-linker; PHD and RING finger domain-containing helicase

Protein name: SNF2 histone linker PHD RING helicase

Product panel: E3 Ligase

Antigen Species: Human

Target Name: SHPRH

IP Dilution: 1:5

Antigen ID: PP-7709

Bead diameter: 0.5 μm

• Artikelnummer: ASBMB-033-1
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: MB-033-1
• Verpackungseinheit: 1 ml
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Monoclonal
• Methode: Immunoprecipitation
• Isotyp: IgG1
• Human Gene ID: 257218
• Wirt: Mouse