Anti-TRAF3 Magnetic Beads

Uniprot: Q13114

Gene Name: TRAF3

Purity: ≥85%

Formulation: Supplied as solution in phosphate buffered saline containing 0.01% BSA and 0.02% sodium azide

Core Sequence: HEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLA

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 99%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: CAP-1; CRAF1; TRAFAMN

Alternative protein names: TNF receptor-associated factor 3; CD40 receptor-associated factor 1; CRAF1; CD40-binding protein; CD40BP; LMP1-associated protein 1; LAP1; RING-type E3 ubiquitin transferase TRAF3

Protein name: TNF receptor associated factor 3

Product panel: E3 Ligase

Antigen Species: Human

Target Name: TRAF3

IP Dilution: 1:5

Antigen ID: PP-602

Bead diameter: 0.5 μm

• Artikelnummer: ASBMB-045-5
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: MB-045-5
• Verpackungseinheit: 5 ml
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine)
• Klonalität: Monoclonal
• Methode: Immunoprecipitation
• Isotyp: IgG1
• Human Gene ID: 7187
• Wirt: Mouse