Anti-TRIM59 Magnetic Beads

Uniprot: Q8IWR1

Gene Name: TRIM59

Purity: ≥85%

Formulation: Supplied as solution in phosphate buffered saline containing 0.01% BSA and 0.02% sodium azide

Core Sequence: IDDLQSAYLKEKDTPQKLLEQLTDTHWTDLTHLIEKLKEQKSHSEKMIQGDKEAVLQYFKELNDTLEQKKKSFLTALCDVGNLINQEYTPQIERMKEIREQQLELMALTISLQEESPLKF

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 83%, Pig - 88%, Cynomolgus monkey - 94%

Alternative gene names: RNF104; TRIM57; TSBF1

Alternative protein names: Tripartite motif-containing protein 59; RING finger protein 104; Tumor suppressor TSBF-1

Protein name: Tripartite motif containing 59

Product panel: E3 Ligase

Antigen Species: Human

Target Name: TRIM59

IP Dilution: 1:5

Antigen ID: PP-2433

Bead diameter: 0.5 μm

• Artikelnummer: ASBMB-031-1
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: MB-031-1
• Verpackungseinheit: 1 ml
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Monoclonal
• Methode: Immunoprecipitation
• Isotyp: IgG1
• Human Gene ID: 286827
• Wirt: Mouse