Anti-TRIM65 Magnetic Beads

Uniprot: Q6PJ69

Gene Name: TRIM65

Purity: ≥85%

Formulation: Supplied as solution in phosphate buffered saline containing 0.01% BSA and 0.02% sodium azide

Core Sequence: DAERLKREAQLRASLEVTQQQATQAEGQLLELRKQSSQIQNSACILASWVSGKFSSLLQALEIQHTTALRSIEVAKTQALAQARDEEQRLRVHLEAVARHGCRIRELLEQVDEQTFLQESQLLQPPGPLGPLTPLQWDEDQQLGDLKQLLSRLCGLLLEEGSHPGAPAKPVDLAPVEAPG

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 55%, Pig - 68%, Cynomolgus monkey - 92%

Alternative gene names: /

Alternative protein names: E3 ubiquitin-protein ligase TRIM65; Tripartite motif-containing protein 65

Protein name: Tripartite motif containing 65

Product panel: E3 Ligase

Antigen Species: Human

Target Name: TRIM65

IP Dilution: 1:5

Antigen ID: PP-7414

Bead diameter: 0.5 μm

• Artikelnummer: ASBMB-041-5
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: MB-041-5
• Verpackungseinheit: 5 ml
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Monoclonal
• Methode: Immunoprecipitation
• Isotyp: IgG1
• Human Gene ID: 201292
• Wirt: Mouse