Anti-XIAP Magnetic Beads

Anti-XIAP Magnetic Beads
Artikelnummer
ASBMB-010-1
Verpackungseinheit
1 ml
Hersteller
Absea Biotechnology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Uniprot: P98170

Gene Name: XIAP

Purity: ≥85%

Formulation: Supplied as solution in phosphate buffered saline containing 0.01% BSA and 0.02% sodium azide

Core Sequence: CLVRTTEKTPSLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKDSMQDESSQTS

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 84%, Rat - 82%, Pig - 88%, Cynomolgus monkey - 99%

Alternative gene names: API3; BIRC4; IAP3

Alternative protein names: E3 ubiquitin-protein ligase XIAP; Baculoviral IAP repeat-containing protein 4; IAP-like protein; ILP; hILP; Inhibitor of apoptosis protein 3; IAP-3; hIAP-3; hIAP3; RING-type E3 ubiquitin transferase XIAP; X-linked inhibitor of apoptosis protein; X-linked IAP

Protein name: X-linked inhibitor of apoptosis

Product panel: E3 Ligase

Antigen Species: Human

Target Name: XIAP

IP Dilution: 1:5

Antigen ID: PP-358

Bead diameter: 0.5 μm
Mehr Informationen
Artikelnummer ASBMB-010-1
Hersteller Absea Biotechnology
Hersteller Artikelnummer MB-010-1
Verpackungseinheit 1 ml
Mengeneinheit STK
Reaktivität Human
Klonalität Monoclonal
Methode Immunoprecipitation
Isotyp IgG2b
Human Gene ID 331
Wirt Mouse
Produktinformation (PDF)
×
MSDS (PDF)
×