FOXL1 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The exact function of FOXL1 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FOXL1

Key Reference: Hassel,S., (2004) Proteomics 4 (5), 1346-1358

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: EDAGDAAQGAAAVAVGQAARTGDGPGSPLRPASRSSPKSSDKSKSFSIDS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Forkhead box protein L1

Protein Size: 345

Purification: Affinity Purified

• Artikelnummer: AVIARP57981_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57981_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Pig (Porcine), Dog (Canine), Cow (Bovine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 2300
• Wirt: Rabbit