Frizzled 4 antibody

Application Note: IHC-P: 5 μg/ml. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.

Calculated MW: 60

Form: Liquid

Buffer (with preservative): PBS, 2% Sucrose, 0.09% Sodium azide.

Concentration: 0.5-1 mg/ml (Please refer to the vial label for the specific concentration.)

Background: This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence. [provided by RefSeq, Jul 2008]

Uniprot ID: Q9ULV1

Antigen Species: Human

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FZD4. Synthetic peptide located within the following region: GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV.

Purification: Purified by affinity chromatography

Conjugation: Unconjugated

Full Name: frizzled class receptor 4

• Artikelnummer: GTX01572-100
• Hersteller: GeneTex
• Hersteller Artikelnummer: GTX01572-100
• Green Labware: Nein
• Verpackungseinheit: 100 μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Immunohistochemistry (paraffin), Western Blotting
• Isotyp: IgG
• Human Gene ID: 8322
• Wirt: Rabbit