FRK Antibody - N-terminal region : HRP

FRK Antibody - N-terminal region : HRP
Artikelnummer
AVIARP54617_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of FRK is not yet known.The protein encoded by this gene belongs to the TYR family of protein kinases. This tyrosine kinase is a nuclear protein and may function during G1 and S phase of the cell cycle and suppress growth.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FRK

Key Reference: Zhang,Y., (2005) Mol. Cell Proteomics 4 (9), 1240-1250

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: LCSPQSQRHGHYFVALFDYQARTAEDLSFRAGDKLQVLDTLHEGWWFARH

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Tyrosine-protein kinase FRK

Protein Size: 505

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54617_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54617_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2444
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×