FRZB Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The protein encoded by this gene is a secreted protein that is involved in the regulation of bone development. Defects in this gene are a cause of female-specific osteoarthritis (OA) susceptibility.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FRZB

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: HSTQANAILAIEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Secreted frizzled-related protein 3

Protein Size: 325

Purification: Affinity Purified

• Artikelnummer: AVIARP54570_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54570_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 2487
• Wirt: Rabbit