FYN Antibody - N-terminal region : Biotin

FYN Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55567_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: FYN is a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein.This gene is a member of the protein-tyrosine kinase oncogene family. It encodes a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein. Alternatively spliced transcript variants encoding distinct isoforms exist.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FYN

Key Reference: Hoe,H.S., (2008) J. Biol. Chem. 283 (10), 6288-6299

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: GCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tyrosine-protein kinase Fyn

Protein Size: 482

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55567_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55567_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2534
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×