English
FYN Antibody - N-terminal region : FITC
FYN Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55567_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate
Description of Target: FYN is a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein.This gene is a member of the protein-tyrosine kinase oncogene family. It encodes a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein. Alternatively spliced transcript variants encoding distinct isoforms exist.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FYN
Key Reference: Hoe,H.S., (2008) J. Biol. Chem. 283 (10), 6288-6299
Molecular Weight: 54kDa
Peptide Sequence: Synthetic peptide located within the following region: GCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYN
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Tyrosine-protein kinase Fyn
Protein Size: 482
Purification: Affinity Purified
Description of Target: FYN is a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein.This gene is a member of the protein-tyrosine kinase oncogene family. It encodes a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein. Alternatively spliced transcript variants encoding distinct isoforms exist.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FYN
Key Reference: Hoe,H.S., (2008) J. Biol. Chem. 283 (10), 6288-6299
Molecular Weight: 54kDa
Peptide Sequence: Synthetic peptide located within the following region: GCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYN
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Tyrosine-protein kinase Fyn
Protein Size: 482
Purification: Affinity Purified
| Artikelnummer | AVIARP55567_P050FITC |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP55567_P050-FITC |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 2534 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
