GABARAP Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Gamma-aminobutyric acid A receptors [GABA(A) receptors] are ligand-gated chloride channels that mediate inhibitory neurotransmission. GABA(A) receptor-associated protein (GABARAP) is highly positively charged in its N-terminus and shares sequence similarity with light chain-3 of microtubule-associated proteins 1A and 1B. This protein clusters neurotransmitter receptors by mediating interaction with the cytoskeleton.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GABARAP

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: IHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Gamma-aminobutyric acid receptor-associated protein

Protein Size: 117

Purification: Affinity Purified

• Artikelnummer: AVIARP58902_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58902_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 11337
• Wirt: Rabbit
• Konjugat: Conjugated, FITC