GAS2L3 Antibody - N-terminal region : FITC

GAS2L3 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55729_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human GAS2L3

Molecular Weight: 64kDa

Peptide Sequence: Synthetic peptide located within the following region: SISIPKSCCRHEELHEAVKHIAEDPPCSCSHRFSIEYLSEGRYRLGDKIL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: GAS2-like protein 3

Protein Size: 590

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55729_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55729_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 283431
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×