GBA2 Antibody : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a microsomal beta-glucosidase that catalyzes the hydrolysis of bile acid 3-O-glucosides as endogenous compounds. Studies to determine subcellular localization of this protein in the liver indicated that the enzyme was mainly enriched in the microsomal fraction where it appeared to be confined to the endoplasmic reticulum. This putative transmembrane protein is thought to play a role in carbohydrate transport and metabolism.

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence MCHLRPTLRDYGRFGYLEGQEYRMYNTYDVHFYASFALIMLWPKLELSLQ

Molecular Weight: 105 kDa

Peptide Sequence: Synthetic peptide located within the following region: MCHLRPTLRDYGRFGYLEGQEYRMYNTYDVHFYASFALIMLWPKLELSLQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Non-lysosomal glucosylceramidase

Protein Size: 927

Purification: Affinity Purified

• Artikelnummer: AVIARP57499_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57499_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Human Gene ID: 57704
• Wirt: Rabbit