GCN5 (727-837), His-tag Recombinant

Products from BPS Bioscience require a minimum order value above 400€

Encompassing Amino Acids: 727-837

Amino Acid Sequence: MHHHHHHLKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK

Applications: Useful for the study of bromodomain binding assays, screening inhibitors, and selectivity profiling.

Description: Human GCN5 or KAT2A containing bromodomain, GenBank Accession No. NM_021078, a.a. 727 - 837 (end) corresponding to single bromodomain with N-terminal His-tag, MW = 14.1 kDa, expressed in an E. coli expression system.

Format: Aqueous buffer solution

Formulation: 40 mM Tris-HCl, pH 8.0, 110 mM NaCl, 2.2 mM KCl, 0.04 % Tween-20, 20% glycerol

Genbank: NM_021078

Storage Stability: At least 6 months at -80°C.

Tags: N-terminal His-tag

Uniprot: Q92830

Warnings: Avoid freeze/thaw cycles.

Biosafety Level: Not applicable (BSL-1)

References: 1. Li, S., et al., J Biol Chem. 2009 Apr 3; 284(14): 9411-7
2. Santillan, D.A., et al., Cancer Res. 2006 Oct 15; 66(20): 10032-9Application Reference:Quantitating the specificity and selectivity of Gcn5-mediated acetylation of histone H3 (2013)

• Artikelnummer: BPS31114
• Hersteller: BPS Bioscience
• Hersteller Artikelnummer: 31114
• Green Labware: Nein
• Verpackungseinheit: 100 µg
• Mengeneinheit: STK