GLIPR1L1 Antibody - middle region : FITC

GLIPR1L1 Antibody - middle region : FITC
Artikelnummer
AVIARP55549_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GLIPR1L1

Molecular Weight: 26

Peptide Sequence: Synthetic peptide located within the following region: NMPPYVRGESCSLCSKEEKCVKNLCKNPFLKPTGRAPQQTAFNPFSLGFL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: GLIPR1-like protein 1

Protein Size: 233

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55549_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55549_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 256710
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×