GLOD4 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The function of GLOD4 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GLOD4

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: EEFEEGCKAACNGPYDGKWSKTMVGFGPEDDHFVAELTYNYGVGDYKLGN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glyoxalase domain-containing protein 4

Protein Size: 298

Purification: Affinity Purified

• Artikelnummer: AVIARP56828_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56828_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 51031
• Wirt: Rabbit