GLUD2 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: Glutamate dehydrogenase (EC 1.4.1.3) catalyzes the reversible oxidative deamination of glutamate to alpha-ketoglutarate using NAD and/or NADP as cofactors.Glutamate dehydrogenase (EC 1.4.1.3) catalyzes the reversible oxidative deamination of glutamate to alpha-ketoglutarate using NAD and/or NADP as cofactors. See also GLUD1 (MIM 138130).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-2348 BC050732.2 1-2348

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GLUD2

Key Reference: Kanavouras,K., (2007) J. Neurosci. Res. 85 (15), 3398-3406

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: MYRYLAKALLPSRAGPAALGSAANHSAALLGRGRGQPAAASQPGLALAAR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glutamate dehydrogenase 2, mitochondrial

Protein Size: 558

Purification: Affinity Purified

• Artikelnummer: AVIARP54827_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54827_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 2747
• Wirt: Rabbit