GLUD2 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: Glutamate dehydrogenase (EC 1.4.1.3) catalyzes the reversible oxidative deamination of glutamate to alpha-ketoglutarate using NAD and/or NADP as cofactors.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GLUD2

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: EGFFDRGASIVEDKLVKDLRTQESEEQKRNRVRGILRIIKPCNHVLSLSF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glutamate dehydrogenase 2, mitochondrial

Protein Size: 558

Purification: Affinity Purified

• Artikelnummer: AVIARP54828_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54828_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Dog (Canine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 2747
• Wirt: Rabbit